PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20526.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 753aa    MW: 84914.5 Da    PI: 6.5138
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20526.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS386.23.8e-1183807511374
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+av+++d++ a++lL+++++++sp gd  qRla++f+ +L+arla+++s++yk l  ++ts    ++ l+a++l+  ++P+ k+s++t N+
  PK20526.1 380 LRSLLIQCAQAVAADDHRSANELLKQVRQHSSPFGDGSQRLASCFADGLEARLAGTGSQIYKGLVNKRTS---AADILKAYRLYLAACPFRKISNFTSNR 476
                689*************************************************************999998...9************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +Il+  ++++ vH+iDf+i +G+QWp+L+q L+ R++gpp+lRiTg++ p++g   +e++ etg+rL+ +Ae+++v+f++++ +ak++e+++leeL++++
  PK20526.1 477 TILDTSAKATSVHVIDFGILYGFQWPTLIQRLSMREGGPPKLRITGIEFPQPGfrPAERVDETGRRLKAYAETFNVTFDYHA-IAKKWETITLEELKIDK 575
                ****************************************************9*****************************.7**************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                ++ l+Vn+ ++ ++l+desv+ es+r++vL+l+k+++P+++++   +  +n++ F++rf eal ++salfd+le  +pr + er+ +E+e++gre+ nv+
  PK20526.1 576 NDFLVVNCLYRGKNLPDESVTAESARNRVLDLIKRIKPDLFIHGITNGAYNAPFFVTRFREALFHFSALFDMLELIVPRWEPERMLIEKEIFGREALNVI 675
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                aceg er+er et+++W+ r++++GF + pls +++k a   +++++ + + ++e++g+l++gWk+r ++++S+W+
  PK20526.1 676 ACEGCERVERPETYKQWQIRIMRSGFVQQPLSRYVMKRAAEKVKTTYHRDFIIDEDNGWLLQGWKGRIIFAISSWK 751
                ***********************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.58354731IPR005202Transcription factor GRAS
PfamPF035141.3E-115380751IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MDQSLRGYAG SGNGVIHFGK GKPLSVISSH NNIMAETRFN NHNHNAFSDH SHMGFHYPQP  60
DLTPAIENTI STLSHDVNSP EDCDFSDTVL QYISQMLMEE EDHEDKTSIV EESSDLRAAE  120
KSFYEVLGKK YPPSPEQNHV FQNGESLEEN FTTSSNNYVH SSCYSNEYLV DNPLYQNLDN  180
YTSQLHCIPE FGVSQSSYSS SNSAISSLDG LLDSPNSTII QAPDLCSENR SMWQFRKGVE  240
EASRFLPTQN DLVGSVEANE LLALVPSKFG TSDVSVKSND ECSPGSSRGR KHPYSDVEDL  300
EDERSSKQAA IYIESTLRSK MFDLVLLCSL GDGHEHLTSF RADLQSDLTK SMQQTGQIKG  360
LSGGKSRGKR QVKKKEVVDL RSLLIQCAQA VAADDHRSAN ELLKQVRQHS SPFGDGSQRL  420
ASCFADGLEA RLAGTGSQIY KGLVNKRTSA ADILKAYRLY LAACPFRKIS NFTSNRTILD  480
TSAKATSVHV IDFGILYGFQ WPTLIQRLSM REGGPPKLRI TGIEFPQPGF RPAERVDETG  540
RRLKAYAETF NVTFDYHAIA KKWETITLEE LKIDKNDFLV VNCLYRGKNL PDESVTAESA  600
RNRVLDLIKR IKPDLFIHGI TNGAYNAPFF VTRFREALFH FSALFDMLEL IVPRWEPERM  660
LIEKEIFGRE ALNVIACEGC ERVERPETYK QWQIRIMRSG FVQQPLSRYV MKRAAEKVKT  720
TYHRDFIIDE DNGWLLQGWK GRIIFAISSW KAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-493847518375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010111448.10.0hypothetical protein L484_021271
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLW9S8520.0W9S852_9R
STRINGVIT_08s0007g00510.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein